PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g46770.1.p
Common NameBRADI_2g46770, LOC100834402
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 313aa    MW: 33445.8 Da    PI: 7.9746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g46770.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-141462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W +eEdell  +v+ +G   +W + +++ g++R++k+c++rw++yl
  Bradi2g46770.1.p 14 RGPWAPEEDELLRSYVRSHGAVgNWIALPHKAGLNRCGKSCRLRWLNYL 62
                      89******************879************************97 PP

2Myb_DNA-binding34.25.8e-1171111446
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        T++Ed  +  + +  G++ W+ Ia++++ gRt++++k++w++
  Bradi2g46770.1.p  71 YTEQEDMVICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                       69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.03966IPR017930Myb domain
SuperFamilySSF466898.58E-2611109IPR009057Homeodomain-like
SMARTSM007173.1E-101364IPR001005SANT/Myb domain
PfamPF002493.8E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-231569IPR009057Homeodomain-like
CDDcd001671.23E-81662No hitNo description
SMARTSM007172.5E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129412.98867117IPR017930Myb domain
PfamPF002491.3E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2170116IPR009057Homeodomain-like
CDDcd001671.33E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWAPE EDELLRSYVR SHGAVGNWIA LPHKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEQEDMVIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMGM  120
GIHQQQQHYH HQGAVGRRGA SASAIATPPP PPAPQSQCAP SSMMHPSPAS ASSAVTTASA  180
GDVACSFMYS DAPAPPALPH YHNAEFSPPV QPTTQAAAAN GSWASGMMAF DDMFLPELIG  240
GGGDQFPLQG DLFAGYLGPL LQDNYRLPSS SSSAQLQLQE LSACYFPNAQ AEMWAAADHA  300
KPPPAGLCPS LT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794311e-134HF679431.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB25 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567000.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1HQG50.0I1HQG5_BRADI; Uncharacterized protein
STRINGBRADI2G46770.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.18e-66myb domain protein 36